Theultimatelist17veganwellnesschristmasgiftideasveganmakeupveganmuaveganbeautyveganskincareveganchristmasablogaboutstuffwhiteandgreen
*This post may contain affiliate links in which case I may earn a small commission at no cost to you. Please know that I would never recommend anything that I don’t actually believe in and that this is just a nice way to help keep the blog running.*

Christmas shopping for anyone is usually no small feat. But Christmas shopping for a vegan, well that might just seem impossible, hah! I’m here to assure you, that it truly doesn’t have to be. Whether you’re vegan & shopping for a vegan or not vegan at all these “vegan” gifts are also “everyone” gifts.

What I mean by that is, two things really. Firstly, veganism goes beyond diet. Meaning, I don’t have an entire list of vegan food gifts but instead, veganism is about causing the least amount of suffering to others. So vegans don’t wear leather or support the fur & down industries. Those “gifts” would not be considered vegan gifts.

And that’s exactly why I’ve comprised this Christmas Gift List That Any Vegan Will Love

Balancemeditationappreviewveganwellnesschristmasgiftideasablogaboutstuff

1. Meditation Subscription – Mental Health Awareness is on the rise and it certainly feels like more people are taking mental health seriously. Thankfully the kind folks at Balance are offering a free year subscription to anyone that signs up.

*To note, there are other meditation subscriptions like Headspace & Calm. I haven’t personally tried those but have heard great things*
Sajediffuserreviewveganwellnesschristmasgiftideasablogaboutstuff

2. Diffuser – I love my diffusers. And not because I’m a weird essential oil lady (no judgment) but simply because of the way it changes a room (ok, I guess that makes me a weird essential oil enthusiast). 

All jokes aside, essential oils can really transform a mood & an environment. Depending on the oil blend you choose, there have been studies to show that these scents can help you… 

  • relax 
  • get a better night’s sleep
  • eliminate odours
  • boost your immune system
  • reduce stress/anxiety and more…

I use a few different ones in my house but my personal faves are the ones from Saje. Mainly because they’re usually very sleek & they feel like a décor item & less like some dinky plastic toy that’s ready to break at any moment. Saje diffusers tend to be a little pricier but they’re built to last. I’ve gone through a few cheap ones while my Saje ones have remained perfectly maintained.

Sajearomadiffuserreviewveganwellnesschristmasgiftideasablogaboutstuff

A few Amazon recommendations:

Christmas Gift Ideas That Any Vegan Will Love Vegan Wellness A Blog About Stuff Amazon 1

1. This diffuser looks so stylish to me. I might pick one up here for my own office!

Christmas Gift Ideas That Any Vegan Will Love Vegan Wellness A Blog About Stuff Amazon 2

2. My mom has this one & she loves the light feature.

3. Body Brush aka. Dry Brushing – Dry brushing is an ancient Ayurvedic practice, which uses a coarse fibre brush all over ones body. It is said to help…

  • exfoliate
  • reduce the appearance of cellulite
  • stimulate the lymphatic system
  • rid the body of toxins
  • increase energy
  • help circulation

I have been dry brushing for about 10 years now. I only do it once a week before a shower. You should always rinse off your dry brush after use & let it dry out in the open so it doesn’t get moldy. I also recommend using a dry brush with a long handle so that you can easily reach your back, etc. 

To use: 

  • If you have sensitive skin use lighter pressure to start. 
  • Using circular motions & starting at your feet, gently work your way up your entire body.
  • Leave your arms for last & work toward your underarms. 
  • Have a nice cool/warm shower afterwards.
  • It is also recommended to practice with an Abhyanga Massage afterwards. 

(Abhyanga Massage is another Ayurvedic ritual where you take a warm oil and massage it all over your body.)

*We could really learn a lot from Ayurveda & should always remember where these rituals came from & respect their origins*

You can find Dry Brushes literally everywhere nowadays. You just want to be certain that you’re buying a brush that is made from vegetable fibers & not poor Boar’s hair. I have two that I purchased from my local health food stores, a short & a long handled brush. 

You could also check these ones out from Amazon:

Bodybrushdrybrushingreviewveganwellnesschristmasgiftideasamazononeablogaboutstuff

1. This one from The Body Shop has great reviews & is made with Cactus Fibers

graceandstelladrybrushbodybrushreviewveganwellnesschristmasgiftideasablogaboutstuff

2. This one has a cellulite massager as well. Grace & Stella

Bamboodrybrushbodybrushreviewveganwellnesschristmasgiftideasablogaboutstuff

3. This one comes with a mini palm brush also. Bamboo

4. Bath Bombs – Since we’re already indulging in the bathroom, let’s talk about a nice good quality bath bomb! I’m talking about the super sudsy, super moisturizing, beautifully scented kind that really lifts your mood. Bath bombs are a great gift idea for anyone! We all could use a lot more baths. 

Baths are said to not only help soothe sore muscles, but they’ve also been known to alter moods & help improve sleep. I know after a nice long warm bath, maybe while reading a good book & sipping on a nice glass of wine or smoking a little weed (it’s legal here in Canada), there’s nothing better than slipping into bed for a nice cozy sleep. 

There’s no denying it, Lush really makes the best bath bombs! And they have so many to choose from including seasonal/holiday editions.

Here are a few of my fav:

Deepsleeplushbathbombreviewveganwellnesschristmasgiftideasablogaboutstuff

1. Deep Sleep 

Marshmallowworldlushbathbombreviewveganwellnesschristmasgiftideasablogaboutstuff

2. Marshmallow World 

Sakuralushbathbombreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Sakura

Of course you can find bath bombs everywhere nowadays. Just keep in mind when you’re shopping that ingredients matter. You or your gift recipient will be bathing in this, so it’s important to ensure that they are good quality. I’ve seen some very nice ones at my local Health Food Stores so you can definitely check there first. And of course, there’s Amazon:

Brubakerbathbombsreviewveganwellnesschristmasgiftideasablogaboutstuff

1. These look good enough to eat! Made with essential oils, Shea butter, Cocoa Butter, & Olive Oil. Brubaker

Zenbathbombsreviewveganwellnesschristmasgiftideasablogaboutstuff

2. I’ve purchased this set before & was impressed with the scent and quality. I love when they press real flowers & petals into the bombs. Zen

5. Salt Lamp – Salt Lamps originated in Pakistani salt mines. They have a reddish pink & white colour and are somewhat delicate. As the lamp is used the salt slowly begins to evaporate creating a dusty white appearance. They are said to:

  • Balance Electromagnetic Radiations 
  • Reduce Allergies
  • Raise Energy Vibrations
  • Reduce Stress
  • Improve Sleep
  • Enhance your Mood
  • Cleanse & Purify the Air
HimalayanSaltLampreviewveganwellnesschristmasideasablogaboutstuffmine

I purchased my medium size salt lamp from (surprise) a local Health Food Store, but again, you can pretty much find these bad boys anywhere nowadays. I’ve even seen them in Home Décor/Furnishing Stores. 

Here are a few found on Amazon:

YouoklightHimalayansaltlampreviewveganwellnesschristmasgiftideasablogaboutstuff

1. This comes in a set of 2. You OK Light

WBMHimalayansaltlampreviewveganwellnesschristmasgiftideasablogaboutstuff

2. This one is quite pretty. WBM

Himalayansaltlampreviewveganwellnesschristmasgiftideasablogaboutstuff

3. This one looks pretty identical to mine. Salt Lamp

swellwaterbottlereviewveganwellnesschristmasgiftideasmineablogaboutstuff

6. S’well Bottle – I say S’well bottles because they have a proven Therma S’well Technology that keeps cold drinks cold & hot ones hot. The larger the bottle the longer it stays cold or hot. I love my S’well bottle. I have their 16 oz. Teakwood Traveler (the traveler style has a wider mouth so it’s easier to add ice cubes or cups of soup). My particular model will stay cold for 24 hours & hot for 12 hours. This is ideal for people who are always on the go, who don’t support bottled water, or those who have to bring lunches to work, etc. 

  • “S’well Travelers feature Therma-S’well® Technology with triple-layered, vacuum-insulated construction designed to keep beverages colder or hotter, longer than all the rest.
  • The Traveler features a wide mouth for stirring up a cup of coffee or adding ice cubes to your favorite beverage. It’s perfectly contoured to fit in your hand and the thick rim makes for easy drinking.
  • Made from 18/8, food-grade stainless steel.
  • Offers a condensation-free exterior that won’t sweat in your hands or bag.
  • The 12oz Traveler is perfect for morning smoothies or a hot cup of joe. Keeps beverages cold for 20 hours and hot for 9.
  • The 16oz Traveler fits a standard bottle of water. Keeps beverages cold for 24 and hot for 12.
  • The 20oz Traveler keeps large iced brews cold and hot beverages hot; easily fits inside a typical backpack. Keeps beverages cold for 36 hours and hot for 15.
  • Add a S’well Traveler Handle for extra easy carrying.
  • BPA/BPS-Free and reusable.
  • Hand-wash only.”

I purchased mine from Indigo but you can also buy them directly from the S’well site. I’ve also seen them in my local Health Food Stores/Grocers.

swellwaterbottlereviewveganwellnesschristmasgiftideasablogaboutstuff

Amazon also seems to have my style water bottle so if that’s easier/more convenient.

reusablestrawsreviewveganwellnesschristmasgiftideasablogaboutstuff

7. Reusable Straws – Plastic is a huge problem and with Covid it’s kind of taken a turn for the worse. We were just starting to get rid of plastic bags & straws and then now we’re dumping more plastic gloves & HAZMAT suites. So, I can’t think of a better time than any to promote the use of glass, metal, or paper straws. It’s super easy to keep on hand. It is also worth noting that many people use straws while consuming hot teas or coffees to prevent teeth stains. The unfortunate side of using plastic straws like this is that the plastic melts in hot liquid releasing dangerous chemicals into your beverage & therefore into your system. 

I’ve found reusable straws in nearly every store I go into now. Even in the bigger supermarkets. Here are a few options from Amazon in case they’re harder to come by for you:

reusablestrawsonereviewveganwellnesschristmasgiftideasablogaboutstuff

1. This is a great looking set. It comes with 8 different sized straws, a travelling case, & two spoolie brushes to keep them clean. They also plant 1 tree with every purchase. UppWell

reusablestrawssetreviewveganwellnesschristmasgiftideasablogaboutstuff

2. I love the soft pastel colours in this silicone set. Also comes with two spoolie brushes. Pastels

telescopicreusablestrawsetreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Probably the most portable set. These two straws are collapsible and come in their own cute little keychain holders. Convenience for the win.

8. Vegan Subscription Box – We all love gifts right? So who wouldn’t love being signed up for a year of monthly gifts through a vegan subscription box? I’ve given subscription boxes as gifts before & my friends have always been so happy because each month they get a new gift & a reminder of how much you care about them. 

Here are a few vegan subscription boxes that I recommend:

1. Vegan Cuts– Vegan cuts is so awesome! They were one of my first vegan subscriptions ever and what sets them apart from other subscriptions is that they have 3 different types of boxes to choose from! They also have their own online shop so you can always buy more of an item if you ended up loving it. They ship to the US, Canada, & Internationally. 

vegancutssnackboxreviewveganwellnesschristmasgiftideasablogaboutstuff

Snack Box – The Snack Box contains 10 or more full size & sample size products. I like to pack the sample size snacks with my lunches. All Snack Boxes are: 

  • 100% Vegan
  • 100% Cruelty Free
  • 10+ Items Per Month
  • Easy to Manage Subscription Renewals
  • Free U.S. Shipping
  • Flexible Subscriptions
vegancutsbeautyboxreviewveganwellnesschristmasgiftideasablogaboutstuff

Beauty Box – The Beauty Box is focused on skincare & body care. They send a minimum of 4 deluxe or regular size luxury skincare each month. I once got a full bottle of Osea moisturizer, which retails for $48CAD alone. The value is definitely in the box. All Beauty Boxes are:

  • 100% Vegan
  • 100% Cruelty Free
  • 4+ Deluxe and Full-Size Items Each Month
  • $60-$110+ Value in Every Box
  • Free U.S. Shipping
  • Easy To Manage Subscription Renewals
  • Non-Toxic Ingredients
vegancutsmakeupboxreviewveganwellnesschristmasgiftideasablogaboutstuff

Makeup Box – The Makeup Box is the exact same as the Beauty Box only it’s all things makeup. From lipsticks, to palettes, I’ve even received some killer brushes from them. And just like the Beauty Box, all boxes are:

  • 100% Vegan
  • 100% Cruelty Free
  • 4+ FULL-SIZE Items each quarter valued at $100+
  • Color Customization for Featured Products
  • Free U.S. Shipping
  • Easy To Manage Subscription Renewals
  • Non-Toxic
petitvoursubscriptionboxreviewveganwellnesschristmasgiftideasablogaboutstuff

2. Petit Vour – Another beauty box that I have heard amazing reviews about but have yet to try is Petit Vour’s beauty box. You create a profile to match your personal skin type/tone & then you’ll receive a minimum of 4 full size products each month. You will also have the opportunity to rate & review your products to earn more points to put towards shopping at their store. 

bombayandcedarsubscriptionboxreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Bombay & Cedar – I have yet to try this box but it is a seasonal or monthly vegan lifestyle box. Meaning, they include all things vegan & wellness. Each box has:

  • Aromatherapy Discovery, Tips & Recipes
  • 5 – 6 products plus two Bombay & Cedar Essential Oils
  • Packed with a retail value of over $100
  • Vegan & Cruelty Free
  • Hand Curated Monthly Theme to Enhance Your Lifestyle
  • Diffusers, Skincare, Snacks, Home Goods, Activities & More
  • Order by the 20th to receive the current month’s box.
  • We ship every month by the last week of the month
  • Automatically renews on the 1st of each month
  • No contracts. No Commitments. Cancel Anytime.

9. Skincare Set – A lot of brands love to release Limited Edition Holiday Gift Sets. It’s a smart way to get a lot of bang for your buck. Most holiday sets have a minimum of $10 savings just for buying it as a bundle. Here are a few great sets to consider:

SoldeJaneiroSplashyCelebrationSetreviewveganwellnesschristmasgiftideasablogaboutstuff

1. Sol de Janeiro Splashy Celebration Set – ($50CAD – $19.50 in savings) The Brazilian Bum Bum cream has become a cult classic at this point. So why not give some of their other products a try? 

This set comes with: 

the Brazilian Joia™ Strengthening + Smoothing Shampoo and Conditioner, the iconic Brazilian Bum Bum Cream, and Brazilian Crush Body Mist.    

Biossanceoverachieversreviewveganwellnesschristmasgiftideasablogaboutstuff

2. Biossance Your Clean Routine/Overachievers Kit – ($77CAD – $53 in savings) This kit will make any skincare lover the happiest ever. This brand is pure soft luxury. I personally use their Rosehip & vegetable Squalane Oil. Great brand, one of my favourites & a great way to introduce the products to your skin/lifestyle in this little kit. 

The kit includes: 

Squalane + Lactic Acid (Gift Size), Squalane + Vitamin C Rose Oil (Travel Size), Squalane + Marine Algae Eye Cream (Travel Size), Squalane + Omega Repair Cream (Travel Size), Squalane + Probiotic Gel Moisturizer (Travel Size)

Drunkelephantthelittlesheadtotoeskincaresetreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Drunk Elephant The Littles Head to Toe trial set – ($64CAD) This is a limited edition set that helps to introduce all of the Drunk Elephant products to you. They run a set like this often but change the packaging or bonus products. Drunk Elephant is a cult classic brand that any beauty or skincare junkie knows about. 

This set includes: 

Cocomino™ Glossing Shampoo, Cocomino™ Marula Cream Conditioner, T.L.C. Happi Scalp™ Scrub, Wild Marula™ Tangle Spray, Kamili™ Cream Body Cleanser, Sili™ Body Lotion, Sweet Pitti™ Deodorant Cream, Neon marula comb, Bag

Jackblackdailyjackskincaresetreviewveganwellnesschristmasgiftideasablogaboutstuff

4. Jack Black Daily Jack Holiday Set – ($48CAD) I love the Jack Black Skincare line. As I’ve mentioned before (insert backlink) I use their Daily SPF Moisturizing lotion on all of my male actors & I even got my husband hooked on it. 

This is a great set to get someone & it includes: 

Performance Remedy™ Turbo Wash™ Energizing Cleanser for Hair & Body, Clean Break™ Oil-Free MoisturizerPure Clean Daily Facial Cleanser

Andaloucannacellskincaresetreviewveganwellnesschristmasgiftideasablogaboutstuff

5. Andalou Naturals CannaCell Botanical Get Started Set – ($24.99) I wanted to include this find on Amazon because this brand is actually really freaken good. I was surprised to find it there to be honest. 

It comes with: 

An exfoliating scrub, a hydrating toner, detoxifying facial mask, a day cream, and a night cream. 

There are a ton of holiday gift sets out there, especially on the Sephora & Ulta websites. Just type in Vegan in your search bar & then refine to holiday gift sets to find even more. Just be sure to check that those brands are both vegan & cruelty free before purchasing. 

10. Masks & Sleep Masks – Not everyone loves a face mask. I know some people who get so bored waiting for it to develop. Especially when it’s a sheet mask and your facial mobility is now limited, haha. But… I think those people actually just need a good sleep mask. That way it is far less intrusive & they can still reap the same benefits as those with more patience. For that reason I’ve included both types of mask ideas.

Farmacysheetmaskreviewveganwellnesschristmasgiftideasablogaboutstuff

1. Farmacy Hydrating Sheet Mask – ($8CAD) Farmacy is another great skincare brand. Most products are vegan aside from any that they use honey with. I’ve tried this sheet mask & I will say my skin felt awesome afterwards. Super hydrated & glowy.

Glowrecipewatermelonglowsleepingmaskreviewveganwellnesschristmasgiftideasablogaboutstuff

2. Glow Recipe Watermelon Glow Sleeping Mask – ($59CAD) This stuff smells soooooo… yummy! Like I want to eat it, haha. This is a sleeping mask. You simply apply the gel like mask, let it dry & you’re good to go. It can get a little peely but who cares, you’re going to bed. Then wash it off in the morning & reveal hydrated glowy skin.

Herbivorebluetansyfacialmaskreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Herbivore Blue Tansy BHA & Enzyme Pore Refining Mask – ($63CAD) This mask might not be for everyone. It is a wash off mask, it goes on in a very opaque blue grey colour, it can get a little tight & cracky as it dries, and it has a very unique scent. I personally really enjoy the smell but that’s personal. I don’t even think I can try & describe it because it’s so different than anything I can recall to describe. But this is a great mask, I’ve personally gone through 2 bottles. Your skin will look tight and firm after use.

*One thing to note: In the colder winter like months you want to choose masks that are more hydrating than detoxifying like clay masks can be. That is why I didn’t include any clay masks.*

11. Eyeshadow Palette – Normally I would say a mini makeup set or kit but with Covid most of us aren’t wearing a lot of makeup on our faces or lips thanks to our new face accessories aka. masks. So, I thought instead it would be nice to include a few versatile eyeshadow palettes to enhance the two features we can show, our EYES.

KVDveganbeautyedgeofrealityfullyrecyclableeyeshadowpalettereviewveganwellnesschristmasgiftideasablogaboutstuff

1. KVD Vegan Beauty Edge of Reality Fully Recyclable Eyeshadow Palette – ($61CAD) I had to include this set for many reasons, my number one though, the entire palette is recyclable!!! That means the planet doesn’t have to pay for us being vainly expressive haha. YAY! But also, the colour selection is gorgeous. I love the neutral soft tones paired with a few bright colours. Keep in mind, you can use eyeshadows as liner as well. So if a bright tone isn’t your thing, try smudging it on top as a dusty liner. KVD shadows are always great quality as well.

Pacificabeautypinknudeseyeshadowpalettereviewveganwellnesschristmasgiftideasablogaboutstuff

2. Pacifica Beauty Pink Nudes Palette – ($22.77CAD) I really love the brand Pacifica so finding this palette on Amazon is a huge score. This palette is very soft & earthy. It has a very natural everyday vibe but it would also make a beautiful bridal palette.

12. Mascara – Everyone could use a great mascara, especially to accompany a great new eyeshadow palette to really draw attention to those eyes. Here are some tried & true Mascara suggestions:

Milkmakeupkushhighvolumemascarareviewveganwellnesschristmasgiftideasablogaboutstuff

1. Milk Makeup Kush High Volumizing Mascara – ($32CAD) User be warned, you are going to want to wipe off the spoolie before applying. I always remove the wand, take the spoolie sideways to drag it across the opening of the mascara tube, turning the wand over a few times after each pass. Once you’ve done this a few times you can now apply the mascara. What you’ll get is long thick full lashes. If you go straight from tube to lashes you’ll look like a hot mess of spider lashes. But I’m telling you, the little extra effort pays off with this one.

Tartelightscameralashes4in1mascarareviewveganwellnesschristmasgiftideasablogaboutstuff

2. Tarte Lights, Camera, Lashes 4–in–1 Mascara – ($30CAD) This mascara is one of my ride or dies. I’ve been using it for years & I always find myself coming back to it. It’s reliable, not chunky, and holds up all day long. It is also quite buildable so you can add an extra coat or two without it looking too thick. It also comes in a waterproof version, which is also great, but for regular day to day use I recommend this one.

Toofacedbetterthansexmascarareviewveganwellnesschristmasgiftideasablogaboutstuff

3. Too Faced Better Than Sex Mascara – ($33CAD) It should be noted that the waterproof version of this is not vegan as it contains beeswax. This mascara is so bomb though and there’s a reason why it instantly became a cult classic. Like the Milk Kush Mascara you’re going to want to remove a little of the excess from the spoolie. After that, your lashes are going to be perfection!

Pacificadreambiglashextending7in1mascarareviewveganwellnesschristmasgiftideasablogaboutstuff

4. Pacifica Beauty Dream Big Lash Extending 7-in-1 Mascara – ($20.51CAD) Another amazing vegan Amazon find. This mascara is great! Not only are the ingredients on the cleaner side but the product itself delivers. Coats your lashes without looking cakey or flakey & creates volume & lift.

13. Tongue Scraper – Tongue scraping is another practice that originates from Ayurveda. Tongue scraping is said to help improve bad breath by removing any toxins & bacteria that can collect on our tongues. When we remove these bacteria we naturally help to create a healthier environment in our mouths as well. It is also said that tongue scraping can even improve our sense of taste. 

To use –

  • I like to tongue scrape before I brush my teeth.
  • It can be pretty gross & can also trigger ones gag reflexes so it’s best to start in the center of your tongue.
  • Take your tongue scraper, hold it between your thumb & 4 fingers like a nut cracker, place it sideways on your tongue & start scraping your tongue towards its tip.
  • I like to rinse it off as I go ‘cause it starts getting gross haha. But you just drag it along your tongue until it picks up less and less grime.
  • Rinse it off & brush your teeth, ta-da!

Obviously these will be found in any health food store & even some drug stores. They come in all sorts of metals & plastic. I highly recommend the metal tools because they last longer & therefore will create less waste in the long run. Here are a few I found on Amazon, including the one I use:

Koshatonguescraperreviewveganwellnesschristmasgiftideasablogaboutstuff

1. This is the one I use. I rinse it off & dry it and then store it in this little cloth baggy that it came in. Kosha

Oapriretonguescrapersetreviewveganwellnesschristmasgiftideasablogaboutstuff

2. This one seems to be the best value. You get two double sets; 4 tongue scrapers (2 different types) and 2 travel cases. Oaprire

tonguescraperreviewveganwellnesschristmasgiftideasablogaboutstuff

3. Another double set. Chiumpro

14. Yoga Gear – It is no surprise that a lot of people in the vegan wellness world also tend to be huge fans of yoga. It’s such a great mental & physical workout/experience and it can be done pretty much anywhere.

Here are a couple of yoga mat suggestions & yoga bags from my favourite vegan bag designer:

1. Something to keep in mind when choosing a yoga mat. People spend a lot of time on their mats, they sweat on them, they lay on them, & they definitely breathe them in, so the quality and materials used in yoga mats is very important. With that being said, quality of materials usually means it can be a bit pricier than say a mat found at Walmart. Obviously you would choose any mat over no mat but the ones featured here are a little more eco conscious. 

dawayecofriendlyyogamatreviewveganwellnesschristmasgiftideasablogaboutstuff

This mat is a large & thick eco friendly mat. Whoever is gifted this will be very happy with its performance no doubt. Daway

mikestudiocanadacorkyogamatreviewveganwellnesschristmasgiftideasablogaboutstuff

This mat is stunning & it’s because it is made out of cork! How cool is that? Mike’s Studio

2. Yoga bags are such an important accessory for a yogi. A good yoga bag should be able to hold your mat and your ID, keys, & water bottle. With the pandemic many of our Local studios are closed so we’re not transporting our mats as much but it would still make a great gift for those who do yoga in the park or those that will be going back to their studios once the world (hopefully) goes back to normal, whatever that looks like for you. Here are a couple of suggestions:

explorelandoxfordyogamatbagreviewveganwellnesschristmasgiftideasablogaboutstuff

This one is the closest match to my own bag. My bag is simple, a slot for my mat & a few pockets for the important stuff. Oxford

Azorayogamatbucketbagreviewveganwellnesschristmasgiftideasablogaboutstuff

This style caught my eye. It’s not one I’ve personally used but I like the idea of a bucket bag yoga bag. Just a big bag you can throw all of the stuff you’ll need inside. Azora

15. Housecoat & Pajamas – It’s not truly Christmas or the Holidays if you weren’t gifted a pair of pajamas, or slippers, or a housecoat, haha. That being said, most of the time the pajamas are pretty lame, but they don’t have to be! Here are some great comfy cozy pajamas that will make any vegan wellness junkie happy:

I love this beautiful elegant & soft robe. (Unfortunately the images couldn’t be captured. But if you click on this link it will take you to the page to view it.)

We all love a man in plaid haha, but seriously, a set like this is classic. (Unfortunately the images couldn’t be captured. But if you click on this link it will take you to the page to view it.)

I love the structure of this robe. It almost has a masculine trenchcoat vibe. I’d love to see this on my husband. (Unfortunately the images couldn’t be captured. But if you click on this link it will take you to the page to view it.)

Fauxwoolmensslippersreviewveganwellnesschristmasgiftideasablogaboutstuff

6. These faux wool slippers will complete this whole look. Slippers

16. Winter Gear – If you live in the colder parts of the world then you will definitely understand how important good quality winterized gear can be. And sadly, so many boot options contain dead animal skin. And so many coats have poor dead animal feathers or dead animal fur trim. So here is a little list of some amazing quality vegan boots & coats.

Nativeshoeschamonixwinterbootsreviewveganwellnesschristmasgiftideasablogaboutstuff

I have these ones and I wear them when I have to work on set exteriors. My feet have actually been so warm in these and we’re talking long 12+ hour days.

Nativeshoesfitzsimmonstrekwinterbootsreviewveganwellnesschristmasgiftideasablogaboutstuff

My husband has these ones & he loves wearing them in the winter & for hikes.

Noizewintercoatforherreviewveganwellnesschristmasgiftideasablogaboutstuff

Gorgeous faux fur Parka for her.

Noizewinterbomberforhimreviewveganwellnesschristmasgiftideasablogaboutstuff

This is a really nice Bomber for guys.

17. Tech – Normally I wouldn’t associate tech like this with wellness but I have two very good reasons…

Applewatchreviewveganwellnesschristmasgiftideasablogaboutstuff

The Apple Watch has incredible health & fitness features. It can help keep you moving & on track with your daily fitness goals. It can monitor your heart rate, track your menstrual cycle, your sleep cycle, and so much more. I highly recommend an apple watch to those that are really into fitness. I freaken love mine. 

The new Apple Watch starts at $529CAD & the SE version starts at $369CAD. To make sure it’s vegan, stick to the metal, silicone, or fabric watchbands.

Airpodsproreviewveganwellnesschristmasgiftideasablogaboutstuff

The Airpod Pros come with customizable ear adapters to ensure proper fit. I have small ears & have always struggled with keeping headphones in. I go for runs wearing my Airpod Pros & have never had one slip out. The Pros also have a noise cancelling feature which comes in real handy when you’re trying to meditate with other people around the house who may or may not be extremely loud haha. 

These too are expensive at $329CAD but if its in your budget, they’ll make an incredible gift. The originals start at $219CAD.

There you have it, my Ultimate Vegan Wellness Christmas Gift List with over 17 amazing vegan friendly gift ideas. Peace & love to all of your families over the holiday season and always.  

If you’re looking to make a Delicious Vegan Feast for Christmas, checkout this article with printable menu cards & the best Xmas dinner recipes.

17 Vegan Wellness Christmas Gift Ideas Vegan Gifts A Blog About Stuff